DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG11037

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:299 Identity:73/299 - (24%)
Similarity:126/299 - (42%) Gaps:43/299 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WNLT-VLLGLTLLALQG------------PTEAMRMRGEPLPGLANIERHRSTEAVP---QGRVI 53
            |:|. .:|..||::.|.            |.|:    |:|...|.......:...:|   :.|||
  Fly     3 WHLVCCVLACTLVSTQVYGQEQEKIVLSLPDES----GQPGKNLTLDVAQLAKIVLPSPHETRVI 63

  Fly    54 GG--TTAAEGNWPWIASIQNAYSYH---LCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWW 113
            ||  ||.|:     :.....|..|.   :||..:|:|..|||||.|..|....:..:|...:...
  Fly    64 GGHVTTNAK-----LGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFLGRMKASEWIVAAGISNL 123

  Fly   114 DLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNI---TLADIDELEEGDKLTFA 175
            :.......|....:...|.:...:.|:|::.|.:.::    .|||   :|..: .|:.|.:|..:
  Fly   124 NQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLK----AKNIGTLSLCSV-SLKPGVELVVS 183

  Fly   176 GWGSSEAMGTYGRY--LQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLI 238
            |||.:...|. |.:  |:..:...:....||...|....:....:|..:...:.||..|:||||:
  Fly   184 GWGMTAPRGR-GPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVLGRKDACTFDSGGPLV 247

  Fly   239 DEQQRLVGIGNWGVPCGRG-YPDVYARTAFYHDWIRTTM 276
            .::| :.||.::|:.|... ||.||....:...:|..::
  Fly   248 FKKQ-VCGIVSFGIGCASNRYPGVYTDVMYVKPFIEKSI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 60/231 (26%)
Tryp_SPc 52..275 CDD:238113 60/233 (26%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 60/231 (26%)
Tryp_SPc 62..283 CDD:238113 60/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.