DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Sems

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:229 Identity:58/229 - (25%)
Similarity:91/229 - (39%) Gaps:11/229 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWW 113
            |.|||||.................::..:||..::.|..|||||.|...........|.|.:...
  Fly    41 QTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRL 105

  Fly   114 DLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADI--DELEEGDKLTFAG 176
            ........|.:......|.....:.|:|::.|:..:    |.|||....:  ..|..|..:..:|
  Fly   106 SEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPM----VGKNIGTLSLCSTALTPGQTMDVSG 166

  Fly   177 WG--SSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLID 239
            ||  :.:..|. |..|:..|...:....|||..:....:.....|..:...:.||..|:||||:.
  Fly   167 WGMTNPDDEGP-GHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVLGKKDACTYDSGGPLVY 230

  Fly   240 EQQRLVGIGNWGVPC-GRGYPDVYARTAFYHDWI 272
            |:| :.||.::|:.| .|.||.||....:...:|
  Fly   231 EKQ-VCGIVSFGIGCASRRYPGVYTDVHYVKPFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 56/225 (25%)
Tryp_SPc 52..275 CDD:238113 56/226 (25%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 56/225 (25%)
Tryp_SPc 44..265 CDD:238113 56/226 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.