DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG4613

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:313 Identity:95/313 - (30%)
Similarity:134/313 - (42%) Gaps:60/313 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTVLLGLTLLALQGPTEAMRMRGE-----------PLPG----LANIERHRS-TEAVPQ-GRVIG 54
            |:.:||   :|.:.|::.....|.           ||.|    ...:.|..| |..||. .|::|
  Fly    78 LSNVLG---VASETPSDTASSLGSTSLSSSASPVFPLEGGGAKAFRVNRCASCTCGVPNVNRIVG 139

  Fly    55 GTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGL-------RPLNL------LVV 106
            ||......:||||.|... ::..||..::::.:|||||.||.|:       |.|.|      |.|
  Fly   140 GTQVRTNKYPWIAQIIRG-TFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSSTHLGV 203

  Fly   107 TGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGD- 170
            |.:|.:            .|.|..:|.....:|||||:|...|...|..:...|.. :.|:..| 
  Fly   204 TRSVAF------------AHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPS-NWLQNFDF 255

  Fly   171 -KLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVD----LGHVCVQMDAGQGACH 230
             |...||||.|:..|:....|||.....:....||........||    .|:|   ...|:.||.
  Fly   256 QKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYV---KTGGRDACQ 317

  Fly   231 GDTGGPLI--DEQQRLVGIGNWGVPCGR-GYPDVYARTAFYHDWIR-TTMNGC 279
            ||:|||||  |...||.|:.::|..|.: ..|.||.|.:.|.:||. .|.:.|
  Fly   318 GDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVNTRDSC 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 77/242 (32%)
Tryp_SPc 52..275 CDD:238113 78/245 (32%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 77/242 (32%)
Tryp_SPc 137..362 CDD:238113 76/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.