DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG10663

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:254 Identity:71/254 - (27%)
Similarity:109/254 - (42%) Gaps:46/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTG--TVDWW 113
            ::|||..|.:|.|||..:|.|.:....||..::...||||||.||..:    |.|..|  .:::.
  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKV----LFVRIGEHNLNYE 566

  Fly   114 DLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIE-------------FNDVTKNITLADIDE 165
            |.......|.:.:.|.||||....:|:|||:|...:.             |..:.||:       
  Fly   567 DGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNV------- 624

  Fly   166 LEEGDKLTFAGWG---SSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQ- 226
                 ..|..|||   :.:|.||  ..|.:|:...:|:..|| |:.....:.....|.....|. 
  Fly   625 -----DCTIIGWGKRRNRDATGT--SVLHKATVPIIPMQNCR-KVYYDYTITKNMFCAGHQKGHI 681

  Fly   227 GACHGDTGGPLI-------DEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTMN 277
            ..|.||:||||:       :....:.||.::|..|. |....:||:...|.||:.:.:|
  Fly   682 DTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVN 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 69/247 (28%)
Tryp_SPc 52..275 CDD:238113 70/249 (28%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 69/247 (28%)
Tryp_SPc 507..735 CDD:238113 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.