DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG16998

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:281 Identity:72/281 - (25%)
Similarity:114/281 - (40%) Gaps:59/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYS 74
            :|.|.||.:.|                    |:::...||.|::||........||:||| ..:.
  Fly     3 ILALILLLICG--------------------HKTSALSPQERIVGGVEVPIHLTPWLASI-TVHG 46

  Fly    75 YHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHND 139
            .:.|.:.::...|::||..||.  .|.:..|..|:. :.|.......|..:.:|.:|:.....||
  Fly    47 NYSCSSALITSLWLVTAGHCVQ--YPDSYSVRAGST-FTDGGGQRRNVVSVILHPDFNLRTLEND 108

  Fly   140 IALLQLSSKIEF--NDVTKNITLADIDELEEGDKLTFAGWGSSEA---------MGTYGRYLQEA 193
            ||||:|......  |.....:.|..::.|..  .|..||||:.:|         .||..:.:.:.
  Fly   109 IALLKLDKSFTLGGNIQVVKLPLPSLNILPR--TLLVAGWGNPDATDSESEPRLRGTVVKVINQR 171

  Fly   194 ------SGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDEQQRLVGIGNWGV 252
                  |..:.|:         .||:    ||. ..||:..|:||:|.||: .:....||.::..
  Fly   172 LCQRLYSHLHRPI---------TDDM----VCA-AGAGRDHCYGDSGAPLV-HRGSSYGIVSFAH 221

  Fly   253 PCG-RGYPDVYARTAFYHDWI 272
            .|. ..:|.||.|.|.|..||
  Fly   222 GCADPHFPGVYTRLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 62/238 (26%)
Tryp_SPc 52..275 CDD:238113 63/239 (26%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 62/238 (26%)
Tryp_SPc 25..242 CDD:238113 61/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.