DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG14990

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:317 Identity:75/317 - (23%)
Similarity:119/317 - (37%) Gaps:65/317 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNRWNL-TVLLGLTLLALQGP--------------TEAMRMRGEPLPGLANIERHRSTEAVPQG 50
            |...|.: |.||...|.:..|.              ||.::.....:.|::|          |.|
  Fly     1 MLKNWTINTFLLVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSN----------PNG 55

  Fly    51 RV----IGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVD 111
            .|    :....:..|.:||:.::.:...|...|::|..|. ||||||.|.|.....::|..|.  
  Fly    56 LVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEV-VLTAASIVVGKTDAEIVVRAGE-- 117

  Fly   112 WWD-------LYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEG 169
             |:       |.:....|:::..|..|...|..|:||||.|::..|.....:.|.|.......:.
  Fly   118 -WNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQ 181

  Fly   170 DKLTFAGWG----SSEAMGTYGRYLQEASGTYLPV---DACREKLQN-----QDDVDLGHVCVQM 222
            .:....|||    :.|......:.::      ||:   ..|:::|:|     ..|:....:|...
  Fly   182 KRCLVTGWGKVAFNDENYSNIQKKIE------LPMINRAQCQDQLRNTRLGVSFDLPASLICAGG 240

  Fly   223 DAGQGACHGDTGGPLI------DEQQRLVGIGNWGVPC-GRGYPDVYARTAFYHDWI 272
            :...|.|.||.|..|.      ..:....||.|||:.| ....|.||.....:.|||
  Fly   241 EKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 60/250 (24%)
Tryp_SPc 52..275 CDD:238113 62/251 (25%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 61/241 (25%)
Tryp_SPc 67..297 CDD:214473 59/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.