DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG32271

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:241 Identity:63/241 - (26%)
Similarity:107/241 - (44%) Gaps:27/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 STEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVT 107
            |.||  ..|::||......:.|::.:::...:: :||..::....|:|||.||.|:....:|||.
  Fly    18 SNEA--NSRIVGGVPVDIASVPYLVNLRIGGNF-MCGGSLVTPQHVVTAAHCVKGIGASRILVVA 79

  Fly   108 GTVDWWDLYAPYYTVSQIHVHCNFDK---PLYHN------DIALLQLSSKIEFNDVTKNITLADI 163
            |..          .:::..|....||   |..:|      |:|:|:|.:.|....|: .|.|.: 
  Fly    80 GVT----------RLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVS-TIELCN- 132

  Fly   164 DELEEGDKLTFAGWGS-SEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQG 227
            ...:.||.:..:|||. :|........::......:|..||..:.:.:..:.....|..:...:.
  Fly   133 TSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVPGVKD 197

  Fly   228 ACHGDTGGPLIDEQQRLVGIGNWGVPCGR-GYPDVYARTAFYHDWI 272
            ||.||:|||.: .|.:|.||.:|||.|.| ..|.||........:|
  Fly   198 ACEGDSGGPAV-YQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 59/231 (26%)
Tryp_SPc 52..275 CDD:238113 59/232 (25%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 59/231 (26%)
Tryp_SPc 25..244 CDD:238113 59/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.