DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG32269

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:306 Identity:81/306 - (26%)
Similarity:126/306 - (41%) Gaps:44/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLLGLTLLA----------------------------LQGPTEAMRMRGEPLPGLA--------N 37
            ::||:.|||                            |.|......:|.....|.|        |
  Fly    30 LILGMLLLAELTQLGEAVTANQQRRNRRLRSDNGTKRLTGTKNQTGIRSNRRQGTARKLSAKRVN 94

  Fly    38 IERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLN 102
            ..:..:|.:..|.|::|||:......|:|..::.  ..:||...::.|.||||||.||.|....:
  Fly    95 QNKKAATSSKIQSRIVGGTSTTISTTPYIVQLRR--GSNLCSGSLITEQWVLTAAHCVKGYSASD 157

  Fly   103 LLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELE 167
            ..|..||...........:||.|||...|.....:.|.|||:|:..:...:: ..|::.:. ..:
  Fly   158 FTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNI-GTISMGNY-RPK 220

  Fly   168 EGDKLTFAGWG-SSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHG 231
            .|.::..|||| :.|...|..:.||.|....:....||:..:.|..:....:|.:. ||:.:|.|
  Fly   221 AGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARA-AGKDSCSG 284

  Fly   232 DTGGPLIDEQQRLVGIGNWGVPCGR-GYPDVYARTAFYHDWIRTTM 276
            |:||| :.....|:||.::|..|.| |||.||........|....|
  Fly   285 DSGGP-VTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQWATNIM 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 66/222 (30%)
Tryp_SPc 52..275 CDD:238113 66/224 (29%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 66/221 (30%)
Tryp_SPc 121..324 CDD:238113 62/208 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.