DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Ser8

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:298 Identity:83/298 - (27%)
Similarity:115/298 - (38%) Gaps:82/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLGLTLLALQGPTEAMRMRGEPLP-GLANIERHRSTEAVPQ-----GRVIGGTTAAEGNWPWIAS 68
            ||..|.|||...|     .|..:| ||.           ||     ||::|||.::..:.||..|
  Fly     3 LLIATFLALLALT-----NGAVIPIGLE-----------PQTSSLGGRIVGGTASSIEDRPWQVS 51

  Fly    69 IQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDK 133
            :|.:.| |.||..|:....::|||.|:.          |.|           |||.:.:....:|
  Fly    52 LQRSGS-HFCGGSIISNNIIVTAAHCLD----------TPT-----------TVSNLRIRAGSNK 94

  Fly   134 PLY------------H---------NDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGW 177
            ..|            |         |||.:::|.:|:.|....|.||:|.... ..|...:.:||
  Fly    95 RTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATP-AHGSAASISGW 158

  Fly   178 GSSEAMGTYGRYLQEASGTYLPVDA-------CREKLQNQDDVDLGHVCVQMDAGQGACHGDTGG 235
            |.:...|       .:|.|.|.||.       |..............:.......:.||.||:||
  Fly   159 GKTSTDG-------PSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAATNKDACQGDSGG 216

  Fly   236 PLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWI 272
            ||:...| |||:.:||..|. ..||.|||..|...||:
  Fly   217 PLVSGGQ-LVGVVSWGRDCAVANYPGVYANIAELRDWV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 68/249 (27%)
Tryp_SPc 52..275 CDD:238113 68/250 (27%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 68/249 (27%)
Tryp_SPc 35..253 CDD:238113 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.