DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and lambdaTry

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster


Alignment Length:251 Identity:78/251 - (31%)
Similarity:115/251 - (45%) Gaps:27/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HRSTEA-VPQ--GRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLR-PL 101
            :|:.|. :|:  ||::||.......:|...|::.. ..|.||..|.....:::||.||..|. |.
  Fly    22 YRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYR-GNHRCGGTIYRSNQIISAAHCVNTLSGPE 85

  Fly   102 NLLVVTGTVDWWDLYAPY--YTVSQIHVHCNFDKPLYHN-----DIALLQLSSKIEFNDVTKNIT 159
            ||.:|.|:.:.|....|.  ..|.:|.:|     |.|..     |.|:|.|....||||..:.|.
  Fly    86 NLTIVAGSSNIWFPTGPQQELEVREIIIH-----PKYRTLNNDYDAAILILDGDFEFNDAVQPIE 145

  Fly   160 LADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGH--VCVQM 222
            ||. :..:....:|..|||::...||....|||.|...:....|:    |...:.|..  :|..:
  Fly   146 LAK-ERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCK----NAYSIMLTSRMLCAGV 205

  Fly   223 D-AGQGACHGDTGGPLIDEQQRLVGIGNWGVPCGR-GYPDVYARTAFYHDWIRTTM 276
            : .|:.||.||:||||: ....|:||.:||..|.| .||.||.......||:..|:
  Fly   206 NGGGKDACQGDSGGPLV-YNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 72/232 (31%)
Tryp_SPc 52..275 CDD:238113 72/234 (31%)
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 71/231 (31%)
Tryp_SPc 36..259 CDD:238113 72/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.