DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and f9a

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_878288.2 Gene:f9a / 359826 ZFINID:ZDB-GENE-030714-2 Length:503 Species:Danio rerio


Alignment Length:286 Identity:81/286 - (28%)
Similarity:122/286 - (42%) Gaps:25/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LQGPTEAMRMRGEPLPGLANIERHRSTEAV---------PQGRVIGGTTAAEGNWPW-IASIQNA 72
            |..||.:..::.:..|..|.:.:....|.:         |:.|:|||.:|..|..|| :|.:..:
Zfish   211 LTNPTNSKDIKEKLAPPRAKLPKWAFEEYLTSPAPTVSGPKSRIIGGNSALPGEIPWQVALVSRS 275

  Fly    73 YSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQI----HVHCNFDK 133
            .....||..||:..||:|||.|:.|....:..:..|..|...:......|..|    |...|...
Zfish   276 TQQVFCGGSILNPLWVITAAHCLLGNHNGSFYIRVGEHDVSKIEGTEQNVDVIKLISHPRYNSKV 340

  Fly   134 PLYHNDIALLQLSSKIEFNDVTKNITLADI----DELEEGDKLTFAGWGSSEAMGTYGRYLQEAS 194
            .|:::|||||:|.|.|......:.|.|..:    ..|:.|...|.:|||.....|.....||:..
Zfish   341 SLFNHDIALLRLRSPIRLTPTVRPICLGPMVFSNTLLQSGTLATVSGWGRVRFQGRSAATLQKIE 405

  Fly   195 GTYLPVDACREKLQNQDDVDLGHVCV-QMDAGQGACHGDTGGPLIDEQQR---LVGIGNWGVPCG 255
            ..|:....|:|  .:.|.:.....|. ..|:.:.||.||:|||.:.....   |.||.:||..|.
Zfish   406 LPYVDRTVCKE--SSSDPITHFMFCAGHSDSPKDACQGDSGGPHVMRYHNTWFLTGIISWGEECA 468

  Fly   256 -RGYPDVYARTAFYHDWIRTTMNGCT 280
             :|...||.:...|:.||:.||...|
Zfish   469 KKGKYGVYTQVGNYYRWIQHTMGVTT 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 69/234 (29%)
Tryp_SPc 52..275 CDD:238113 70/236 (30%)
f9aNP_878288.2 GLA 19..83 CDD:214503
EGF_CA 84..120 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 253..486 CDD:214473 69/234 (29%)
Tryp_SPc 254..489 CDD:238113 70/236 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.