DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG4793

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:283 Identity:69/283 - (24%)
Similarity:112/283 - (39%) Gaps:46/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTT-------AAEGNWPWIASIQNAYS- 74
            ||.|.:|   ..:|||          ||.....|:..|.|       |.:|..||:.::.::.| 
  Fly    71 LQYPVQA---DNQPLP----------TECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSR 122

  Fly    75 YHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYH-- 137
            ..|.|..::....|||:::....:....|:|..|.   ||..:  .|..:.|......|.:.|  
  Fly   123 LPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGE---WDFES--ITEERAHEDVAIRKIVRHTN 182

  Fly   138 -------NDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAM-GTYGRYLQEAS 194
                   |:.|||.|:..::.:.....|.|...:.....::...:|||...|: .:|...|::..
  Fly   183 LSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIE 247

  Fly   195 GTYLPVDACREKLQ---NQDDV-DLGHVCVQMDAGQGACHGDTGGPLI------DEQQRLVGIGN 249
            ...:....|:.|||   .:|.: |...:|...:.|:..|.||.|.||.      ..:..|:||.|
  Fly   248 LPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVN 312

  Fly   250 WGVPCGRGYPDVYARTAFYHDWI 272
            :|..||...|..|...:....||
  Fly   313 FGFGCGGPLPAAYTDVSQIRSWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 58/248 (23%)
Tryp_SPc 52..275 CDD:238113 59/249 (24%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 57/236 (24%)
Tryp_SPc 105..335 CDD:214473 55/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.