DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:260 Identity:75/260 - (28%)
Similarity:117/260 - (45%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 STEAVP------------QGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCV 95
            |:|.:|            |.|::||..|:...:||||.:..: ....||..::..:.:||||.||
  Fly   379 SSEGLPLQCGNKNPVTPDQERIVGGINASPHEFPWIAVLFKS-GKQFCGGSLITNSHILTAAHCV 442

  Fly    96 AGLRPLNLLVVTGTVDWWDLYAPYYT------VSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDV 154
            |.:...::..:|..:..:::...:..      :.::..|..|:....|||:|:|.||..:.|...
  Fly   443 ARMTSWDVAALTAHLGDYNIGTDFEVQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTRE 507

  Fly   155 TKNITLADIDELE----EGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDL 215
            .:.|.|......:    .|...|.|||||....|.....||:..   :|:....|..:.......
  Fly   508 IQPICLPTSPSQQSRSYSGQVATVAGWGSLRENGPQPSILQKVD---IPIWTNAECARKYGRAAP 569

  Fly   216 GHVCVQM-DAGQGA---CHGDTGGPL-IDEQQRL--VGIGNWGVPCGRG-YPDVYARTAFYHDWI 272
            |.:...| .|||.|   |.||:|||: |::..|.  |||.:||:.||:| ||.||.|......||
  Fly   570 GGIIESMICAGQAAKDSCSGDSGGPMVINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWI 634

  Fly   273  272
              Fly   635  634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 69/238 (29%)
Tryp_SPc 52..275 CDD:238113 70/239 (29%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 69/238 (29%)
Tryp_SPc 400..637 CDD:238113 70/239 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.