DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Phae1

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:261 Identity:73/261 - (27%)
Similarity:109/261 - (41%) Gaps:65/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASC------------VAGLRP 100
            |:|||:||:.||..:.|:..|:|.. ..|.|.|.||:..|::|||.|            |||   
  Fly    32 PEGRVVGGSPAAVNSAPYAVSMQYG-GTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAG--- 92

  Fly   101 LNLLVVTGTVDWW-----------DLY----APYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIE 150
              .:.|.||....           |||    .||                   ||.::...:...
  Fly    93 --SIAVDGTASTTQTRSITYFVINDLYTGGTVPY-------------------DIGMIYTPTAFV 136

  Fly   151 FNDVTKNITLADIDELEEGDKLTFAGWGSSEAMGT--YGRYLQEASGTYLPV---DACREKLQNQ 210
            ::.....:||.....:..|....: ||||:....|  |...||.|  |.:|:   .:|...|..:
  Fly   137 WSAAVAPVTLPSSGVVPTGTANLY-GWGSTSTTNTASYPSTLQVA--TNVPIISLSSCESALGTK 198

  Fly   211 -DDVDLGHVCV-QMDAGQGACHGDTGGPLIDEQQRLVGIGNWG-VPCGR-GYPDVYARTAFYHDW 271
             .||...::|. .:..|...|..|:||||: :...|:||.:|| :|||: ..|.||.:.:.:..|
  Fly   199 GSDVHSTNLCTGPLTGGVSICTSDSGGPLV-QGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISW 262

  Fly   272 I 272
            |
  Fly   263 I 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 69/256 (27%)
Tryp_SPc 52..275 CDD:238113 70/257 (27%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 69/256 (27%)
Tryp_SPc 36..266 CDD:238113 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.