DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG5390

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:259 Identity:68/259 - (26%)
Similarity:111/259 - (42%) Gaps:42/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PQG---RVIGGTT--AAEGNWPWIASI---QNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLL 104
            |.|   ::.|...  |..|.:||:.:|   :...:.:.||..::....|||||.||...:|.:::
  Fly   140 PNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIV 204

  Fly   105 VVTGTVDWWDL--------YAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLA 161
            |..|.   ||.        :...| |.:|..|..|:|...:||:|::.|.|.....:..:.:.|.
  Fly   205 VRAGE---WDTQTQTEIRRHEDRY-VKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLP 265

  Fly   162 DIDELEEGDKLTFAGWGSSEAMGTYGRY---LQEASGTYLPVDACREKLQNQDDVDLGH------ 217
            ::.:..:.|:....|||.:: .|..|.|   |::.....:|...|...|:   :..||.      
  Fly   266 NVGDKFDFDRCYATGWGKNK-FGKDGEYQVILKKVDMPVVPEQQCETNLR---ETRLGRHFILHD 326

  Fly   218 --VCVQMDAGQGACHGDTGGPLI----DEQQRL--VGIGNWGVPCGR-GYPDVYARTAFYHDWI 272
              :|...:..:..|.||.|.||:    .::.|.  .||..||:.||. ..|.|||..|....||
  Fly   327 SFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 64/251 (25%)
Tryp_SPc 52..275 CDD:238113 66/252 (26%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 65/246 (26%)
Tryp_SPc 153..390 CDD:214473 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.