DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG3355

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:246 Identity:76/246 - (30%)
Similarity:117/246 - (47%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYH--LCGAIILDETWVLTAASCVAGLR---PLNLLVV---- 106
            |::||.......:||.|.:.....|.  .||..::::.:|||||.||.|.|   .:.||.:    
  Fly    75 RIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRSS 139

  Fly   107 --TGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEG 169
              .|.|         ..|.|..||.|:|.....||:|||:|.|.:......:.:.|.:.:...:|
  Fly   140 RDPGIV---------RKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDG 195

  Fly   170 DKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQM--DAGQGACHGD 232
            .....||||..:..|....||||.:...:....||: .:.:|.:....:|..:  ..|:.||.||
  Fly   196 KTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQ-TRYKDKIAEVMLCAGLVQQGGKDACQGD 259

  Fly   233 TGGPLI--DEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIR-TTMNGC 279
            :|||||  :.:.:|.|:.::|..|. :..|.||||.:.:.|||| .|.:||
  Fly   260 SGGPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTADGC 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 70/236 (30%)
Tryp_SPc 52..275 CDD:238113 72/239 (30%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 70/236 (30%)
Tryp_SPc 76..305 CDD:238113 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.