DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG4271

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:226 Identity:73/226 - (32%)
Similarity:99/226 - (43%) Gaps:18/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLY 116
            :..|..|....|.::||:. ...||.||..::|...|||||.||.......:.|..||.   |:|
  Fly    19 IYNGVEAKFDFWTFLASVW-VSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTP---DIY 79

  Fly   117 --APYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGS 179
              .....|:.:.||.|:..  :.||||||.|...:....||| |.|| ..|..|.:..:.|||| 
  Fly    80 RGGRIIRVTALVVHENYKN--WDNDIALLWLEKPVLSVRVTK-IPLA-TKEPSENEYPSNAGWG- 139

  Fly   180 SEAMGTY--GRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDEQQ 242
            .:.:.:|  .|.||.......|...|.|:|......:|  :|. .......|.||.||||: ...
  Fly   140 EKLLESYVVTRKLQNGVTKIRPRSMCAEELVEPVGEEL--LCA-FYTENDICPGDYGGPLV-LAN 200

  Fly   243 RLVGIGNWGVPCGRG-YPDVYARTAFYHDWI 272
            ::|||...|..||.. .|.:|.....|.:||
  Fly   201 KVVGIAVQGHGCGFAVLPSLYTNVFHYLEWI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 71/224 (32%)
Tryp_SPc 52..275 CDD:238113 73/226 (32%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 73/226 (32%)
Tryp_SPc 19..231 CDD:214473 71/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.