DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Send1

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:247 Identity:79/247 - (31%)
Similarity:114/247 - (46%) Gaps:45/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCV----AGLRPLNLL---- 104
            |..|:|||::....:.||..|:| .|..|.||..|..:|.::|||.|:    ..:|..:.|    
  Fly    26 PSERIIGGSSMDITDVPWQVSLQ-YYGEHFCGGSIYSKTIIITAAHCIKEGERSIRAGSSLHDSG 89

  Fly   105 -VVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEE 168
             ||.|             |....:|..|||....||:|:|:|||.:.|:|..:.|.||:.|....
  Fly    90 GVVVG-------------VEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTS 141

  Fly   169 GDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQN---QDDVDLGHVCVQMDAGQGACH 230
            ...|. .|||....: ...|.||.......|:..|:.|..|   .:|:..|.:      |:|.|:
  Fly   142 SSALA-TGWGRGNFL-IRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICAGRM------GKGGCY 198

  Fly   231 GDTGGPLIDEQQRLVGI----GNWGVPC-GRGYPDVYARTAFYHDWIRTTMN 277
            ||:||||:...| ||||    ||  :.| |   ..:||..|.|.:||.:.::
  Fly   199 GDSGGPLVFNGQ-LVGITSRTGN--IVCLG---SSLYASVARYRNWILSAID 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 76/237 (32%)
Tryp_SPc 52..275 CDD:238113 77/239 (32%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 76/237 (32%)
Tryp_SPc 30..239 CDD:238113 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.