DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Ser6

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:280 Identity:85/280 - (30%)
Similarity:131/280 - (46%) Gaps:44/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTVLLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQN 71
            :.:||...||.|..|.::       .||..|            |||:||..|.:..:|...|::|
  Fly     6 VAILLCSFLLFLVLPVQS-------APGKLN------------GRVVGGEDAVKNQFPHQVSLRN 51

  Fly    72 AYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYA---------PYYTVSQIHV 127
            |.| |.||..||..|::||||.||:. ..:|.::.....:.:.:.|         ....|:::.|
  Fly    52 AGS-HSCGGSILTRTYILTAAHCVSN-EDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIV 114

  Fly   128 HCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQE 192
            |..:..  :.||:|||:|.|.:..:...:.|.|..:|...:.| :..:|||..:..|...||||.
  Fly   115 HEEYGN--FLNDVALLRLESPLILSASIQPIDLPTVDTPADVD-VVISGWGRIKHQGDLPRYLQY 176

  Fly   193 ASGTYLPVDACREKLQNQDDVDL---GHVCVQMDAGQGACHGDTGGPLIDEQQRLVGIGNWGVP- 253
            .:...:....|.|.      :|.   |.:|:......|||:||:|||.:...| |||:..:.|. 
  Fly   177 NTLKSITRQQCEEL------IDFGFEGELCLLHQVDNGACNGDSGGPAVYNNQ-LVGVAGFVVDG 234

  Fly   254 CGRGYPDVYARTAFYHDWIR 273
            ||..|||.|||..::.|||:
  Fly   235 CGSTYPDGYARVFYFKDWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 73/233 (31%)
Tryp_SPc 52..275 CDD:238113 74/235 (31%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 73/233 (31%)
Tryp_SPc 32..256 CDD:238113 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.