DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Prss34

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:261 Identity:67/261 - (25%)
Similarity:108/261 - (41%) Gaps:56/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VIGGTTAAEGNWPWIASI-----QNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVD 111
            ::||...:...:||..|:     :::...|.||..::...||||||.||   ||..:        
Mouse    35 IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCV---RPKEV-------- 88

  Fly   112 WWDLYAPYYTVSQIHV--------------HCNFDKPLYHN---DIALLQLSSKIEFNDVTKNIT 159
              :.|.....|.|:.:              |..|.:.|...   |||||:|.:::..::....::
Mouse    89 --EAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSEHVYPVS 151

  Fly   160 LADIDELEEGDKLT--FAGWGSSEAMGTY-----GRYLQEASGTYLPVDACREKLQNQDDVDLGH 217
            | ....|....|.|  .||||..|   .|     ..:|:|.:...:..:.|.:|.|.....|...
Mouse   152 L-PAASLRISSKKTCWVAGWGVIE---NYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTT 212

  Fly   218 VCVQMD------AGQGACHGDTGGPLI---DEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWI 272
            ..::.|      .|:.:|..|:||||:   :.....||:.:||:.|| ..:|.||.|...|..||
Mouse   213 RIIKDDMLCAGKEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYVSWI 277

  Fly   273 R 273
            :
Mouse   278 K 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 65/258 (25%)
Tryp_SPc 52..275 CDD:238113 67/261 (26%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 66/259 (25%)
Tryp_SPc 35..277 CDD:214473 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.