DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG4653

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:233 Identity:71/233 - (30%)
Similarity:108/233 - (46%) Gaps:32/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVA-------------GLRPLNLLVVTGT 109
            |..|:.|...|::. ...|:||..::.|.|:||||.||:             .:|..::..:|| 
  Fly    31 AEVGSQPHSISLRR-NGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTG- 93

  Fly   110 VDWWDLYAPYYTVSQIHVHCNFDK--PLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKL 172
                   .....:|:|.:|.|:..  .:..||:|||:|.:.:..|..|..|.|| .:....|.::
  Fly    94 -------GQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLA-TERPAAGSQI 150

  Fly   173 TFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQ-MDAG-QGACHGDTGG 235
            .|:|||||:..|:....||.|:...|....|:.:|..|.: ||  :|:. :|.. .|.|.||.|.
  Fly   151 IFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQE-DL--LCLSPVDEDFAGLCSGDAGA 212

  Fly   236 PLIDEQQRLVGIGNWGVP-CGRGYPDVYARTAFYHDWI 272
            |.....| ||||..:.|. ||...||.|.....:.:||
  Fly   213 PASYNNQ-LVGIAAFFVSGCGSEQPDGYVDVTQHLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 69/231 (30%)
Tryp_SPc 52..275 CDD:238113 71/233 (30%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 71/233 (30%)
Tryp_SPc 30..249 CDD:214473 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.