DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG9673

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:256 Identity:88/256 - (34%)
Similarity:131/256 - (51%) Gaps:45/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 STEAVPQGRVIGGTTAAEGNWPWIASIQNAYS-YHLCGAIILDETWVLTAASCVA--GLRPLN-- 102
            |.||.||||::||...|:|.:||.||::  |: .|:|...|:....:||||.||:  |:.|::  
  Fly    20 SAEASPQGRILGGEDVAQGEYPWSASVR--YNKAHVCSGAIISTNHILTAAHCVSSVGITPVDAS 82

  Fly   103 -LLVVTGTVDWWDLYA--PYYTVSQIHVHCNFDKPLYHN---DIALLQLSSKIEFNDVTKNITL- 160
             |.|..||:   :.||  ....|..:.:|     |.|.|   |||:|:|...:.|:|..::|.| 
  Fly    83 TLAVRLGTI---NQYAGGSIVNVKSVIIH-----PSYGNFLHDIAILELDETLVFSDRIQDIALP 139

  Fly   161 -------ADID-ELEEGDKLTFAGWGS-SEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLG 216
                   .|:| ||..|..:..||||. |:...:|.:  |:|:...|....|      :.:...|
  Fly   140 PTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTLSRSLC------EWEAGYG 196

  Fly   217 H---VCVQMDAGQGACHGDTGGPLIDEQQRLVGIG--NWGVPCGRGYPDVYARTAFYHDWI 272
            :   ||:....|:|.|.||.|..:||:.:.|.|:.  |:| |||..||||..|.::|..||
  Fly   197 YESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFG-PCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 80/246 (33%)
Tryp_SPc 52..275 CDD:238113 81/247 (33%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 80/246 (33%)
Tryp_SPc 29..259 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.