DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and prss59.1

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:244 Identity:62/244 - (25%)
Similarity:109/244 - (44%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAG-----LRPLNLLV 105
            |:...:::||......:.||.||:.:  .||.||..::.|.||::||.|...     |...|:::
Zfish    15 ALDDDKIVGGYECQPNSQPWQASLNS--GYHFCGGSLVSEYWVVSAAHCYKSRVEVRLGEHNIVI 77

  Fly   106 VTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITL-----ADIDE 165
            ..||       ..:.|..::..:.|:|.....:||.|::||.....|...:.:.|     ||   
Zfish    78 NEGT-------EQFITSEKVIRNPNYDSWDLDSDIMLIKLSKPATLNKYVQPVALPNGCAAD--- 132

  Fly   166 LEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDV--DLGHVCVQMDAGQGA 228
               |.....:|||::.:.......||...   :|:.:.|:...:...:  |.......::.|:.:
Zfish   133 ---GTMCRVSGWGNTMSSTADSNKLQCLE---IPILSDRDCNNSYPGMITDTMFCAGYLEGGKDS 191

  Fly   229 CHGDTGGPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTM 276
            |.||:|||::...: |.||.:||..|. :.:|.||.:...:..||..||
Zfish   192 CQGDSGGPVVCNGE-LHGIVSWGYGCAEKNHPGVYGKVCMFSQWIADTM 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 57/233 (24%)
Tryp_SPc 52..275 CDD:238113 59/235 (25%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 57/233 (24%)
Tryp_SPc 21..238 CDD:238113 59/235 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.