DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG33159

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:233 Identity:63/233 - (27%)
Similarity:99/233 - (42%) Gaps:12/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASI-QNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWD 114
            |::||........|::..: ||  .|.:||..::....||:||.||.|.:|....|..| ....|
  Fly    25 RIVGGKETTISEVPYLVYLRQN--GYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAG-ASRLD 86

  Fly   115 LYAPYY-TVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLT-FAGW 177
            ..||.. .|...|...::....:..|:|||||...:.... .|..|::......||:... .:||
  Fly    87 QEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTP-GKVATISPCRNPPEGNAYARISGW 150

  Fly   178 G-SSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDEQ 241
            | :.|........::......||...|:........:....:|..:...:.:|.||:||||:...
  Fly   151 GVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRG 215

  Fly   242 QRLVGIGNWGVPCGR-GYPDVYARTAF--YHDWIRTTM 276
            | :.||.:||..|.| .:|.||...|.  .|::|..|:
  Fly   216 Q-VCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 61/227 (27%)
Tryp_SPc 52..275 CDD:238113 61/229 (27%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 59/220 (27%)
Tryp_SPc 26..251 CDD:238113 61/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.