DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG33127

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:298 Identity:94/298 - (31%)
Similarity:128/298 - (42%) Gaps:50/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTVLLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVP---QGRVIGG-TTAAEGNWPWIA 67
            |:.|..|.||||.|..:        ||.:.::.. |.||.|.   |..:|.| ......|.|::.
  Fly     2 LSPLFLLPLLALAGAAK--------LPHIQHLTL-RDTEQVHAEIQPLIIDGYDVQGVDNVPYLV 57

  Fly    68 SIQ--NAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYY---------T 121
            |:.  .|...|||||.|:.:.|:||||.||..||..|...| ||        |.|         |
  Fly    58 SLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAV-GT--------PVYAGIINRSNVT 113

  Fly   122 VSQIH------VHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSS 180
            .:|:.      .|.:|:.....::||||.:|...|:|...:.|.|.||::..........|||.:
  Fly   114 AAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGLT 178

  Fly   181 EAMG-TYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPL----IDE 240
            :..| .|.:.||.|....|....|:|.|.....:....||.|:.    .|:||.|.||    |..
  Fly   179 DPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQVK----TCYGDGGTPLIYWPITG 239

  Fly   241 QQRLVGIGNWG-VPCG-RGYPDVYARTAFYHDWIRTTM 276
            ...|||:|:|. :||| ...|.||.....|..||..|:
  Fly   240 PAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 76/245 (31%)
Tryp_SPc 52..275 CDD:238113 78/247 (32%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 78/247 (32%)
Tryp_SPc 41..273 CDD:214473 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.