DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG31681

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:284 Identity:83/284 - (29%)
Similarity:130/284 - (45%) Gaps:47/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTVLLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQN 71
            |.:||.: |:::.|...|.|     :||             |:.|::||:.......||..|:||
  Fly     3 LRLLLSI-LVSIAGLACAAR-----IPG-------------PEERIVGGSYIPIEYVPWQVSVQN 48

  Fly    72 AYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLY 136
             .|.|.||.:|..:..:||||.|::.:...:|.|..|: .:|........|.:...|..:...||
  Fly    49 -NSLHCCGGVIYSDRAILTAAHCLSNVTVTDLSVRAGS-SYWSKGGQVLKVLKTIAHPKYVPKLY 111

  Fly   137 H-NDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPV 200
            : .|||:|.|.:.:......|.|.||:...: .|..:..:|||          |.:|.|....|:
  Fly   112 NPYDIAVLILEAPLRLGGTVKKIPLAEQTPV-AGTIVLTSGWG----------YTRENSSFLWPI 165

  Fly   201 -DACREKLQNQDDV--DLGHVCVQMDA----GQ--GACHGDTGGPLIDE----QQRLVGIGNWGV 252
             ......:.|:.|.  ...||.:.:|.    ||  ..|.||:|||||:.    .::|:|:.:||.
  Fly   166 LQGVHVAILNRTDCLKAYKHVNITIDMICADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGD 230

  Fly   253 PCGRGYPDVYARTAFYHDWIRTTM 276
            .||.. |.||...||:|:||:.|:
  Fly   231 GCGTN-PGVYEDIAFFHNWIKYTV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 70/234 (30%)
Tryp_SPc 52..275 CDD:238113 71/236 (30%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 70/234 (30%)
Tryp_SPc 29..250 CDD:238113 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.