DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG31267

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:272 Identity:120/272 - (44%)
Similarity:170/272 - (62%) Gaps:7/272 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSY 75
            |.|.||||.....::|.|       |.......|......|::||..:.....|::.|:||||..
  Fly    11 LVLVLLALSFSEASLRRR-------AFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGN 68

  Fly    76 HLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDI 140
            |.|...|:.:.||:|||||:||||..|:.|||.|.:.|......|:|..|.:|||||.|:|||||
  Fly    69 HFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDI 133

  Fly   141 ALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACRE 205
            ||::..:..:::|||:|||:|.:::|.:|:.||..|:||:|..|.:...||:...||:..:.|..
  Fly   134 ALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNA 198

  Fly   206 KLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDEQQRLVGIGNWGVPCGRGYPDVYARTAFYHD 270
            ......|:|:||:|.....|.||||||||||::|.:.||||:||||||||.|:|||:||.:||:.
  Fly   199 TYGGTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYGFPDVFARISFYYS 263

  Fly   271 WIRTTMNGCTIA 282
            ||.:|:|||.|:
  Fly   264 WIISTINGCAIS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 103/220 (47%)
Tryp_SPc 52..275 CDD:238113 104/222 (47%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 103/220 (47%)
Tryp_SPc 45..268 CDD:238113 104/222 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461280
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3CKRB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.