DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG32808

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:238 Identity:79/238 - (33%)
Similarity:124/238 - (52%) Gaps:15/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GRVIGGTTAAEGNWPWIASIQNAYS-YHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWW 113
            |:::.||||..|.:|::.|::.|.| .|.|||.:|:..||||||.||.|..|..|.:..|:....
  Fly    28 GKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLA 92

  Fly   114 DLYAPYYTVSQIHVHCNFD-KPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGD-KLTFAG 176
            ...:....|:.|.||..:: :..|.||||||||:..:..:...:.:.|.:..::..|: ....||
  Fly    93 RNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAG 157

  Fly   177 WGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQM-DAGQGACHGDTGGPLI-- 238
            ||.:...|...::||:..........|.|:  :|..:....:|..: :.|:|.|.||:||||:  
  Fly   158 WGLNATGGVVQQHLQKVKLQVFSDTECSER--HQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLI 220

  Fly   239 --DEQQRLVGIGNWGV-PCGR-GYPDVYARTAFYHDWIRTTMN 277
              |.|   |||.:|.: ||.| .:|.|:...:.|.|||..|:|
  Fly   221 GSDTQ---VGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 74/230 (32%)
Tryp_SPc 52..275 CDD:238113 76/232 (33%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/230 (32%)
Tryp_SPc 30..258 CDD:238113 76/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.