DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Prtn3

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:282 Identity:75/282 - (26%)
Similarity:129/282 - (45%) Gaps:46/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QGPTEAM--RMRGEPLP--------GLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAY 73
            :||...:  |:...|:|        .||.:..|.:.:|   .:::||..|...:.|::||:|.:.
  Rat   158 RGPRPQLPPRVSRSPIPRSPRLPCLRLAGVRFHGAVQA---SKIVGGHEARPHSRPYVASLQLSR 219

  Fly    74 S--YHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYA-----PYYTVSQIHVHCNF 131
            |  .|.||..::...:|||||.|   |:.::..:||..:...||.:     ..:|::|:..: |:
  Rat   220 SPGSHFCGGTLIHPRFVLTAAHC---LQDISWQLVTVVLGAHDLLSSEPEQQKFTITQVFEN-NY 280

  Fly   132 DKPLYHNDIALLQLSSKIEFNDVTKNITLADIDE----LEEGDKLTFAGWGSSEAMGTYGRYLQE 192
            :.....||:.||||:......   |.:.:|.:.:    |.:|.:....|||.........|.|.|
  Rat   281 NPEETLNDVLLLQLNRPASLG---KQVAVASLPQQDQSLSQGTQCLAMGWGRLGTRAPTPRVLHE 342

  Fly   193 ASGTYLPVDACREKLQNQDDVDLGHVCVQMD-AGQGACHGDTGGPLIDEQQRLVGIGNWGV-PCG 255
            .:.|.:.. .|||.          :||..:. ...|.|.||:|||||. ...|.|:.::.: .|.
  Rat   343 LNVTVVTF-LCREH----------NVCTLVPRRAAGICFGDSGGPLIC-NGILHGVDSFVIRECA 395

  Fly   256 R-GYPDVYARTAFYHDWIRTTM 276
            . .:||.:||.:.|.:||.:.:
  Rat   396 SLQFPDFFARVSMYVNWIHSVL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 64/234 (27%)
Tryp_SPc 52..275 CDD:238113 66/236 (28%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.