DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and C1r

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001128027.1 Gene:C1r / 312705 RGDID:1309091 Length:707 Species:Rattus norvegicus


Alignment Length:308 Identity:74/308 - (24%)
Similarity:131/308 - (42%) Gaps:69/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLALQGPTEAMR--------------MRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPW 65
            ::...|.:|::|              ..||.:|....:..........:.|:|||..|..||:||
  Rat   413 MMTRAGSSESVRGIYTCTPQGIWKNEEEGEKMPRCLPVCGKPVNPVTQKQRIIGGQKANPGNFPW 477

  Fly    66 IASIQNAYSYHLCGAIILDETWVLTAASCV---AGLRPLNLLVVTGTVDWWDLYAPYYTVSQIH- 126
            .| ..|.:...  |..:|.:.|:||||..:   ...:..|:.|..      |::..:..|.:|. 
  Rat   478 QA-FTNIHGRG--GGALLGDRWILTAAHTIYPKEHNKENNVNVSK------DVFLGHTNVEEIKK 533

  Fly   127 ----------VHCNF--DKP-LYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTF-AGW 177
                      :|.::  |:| .:..|||||:|.:.:........|.|.|.:...:.|.:.: :|:
  Rat   534 LGHHPVRRVIIHPDYRQDEPNNFEGDIALLELENSVTLGPNLLPICLPDNETFYDKDLMGYVSGF 598

  Fly   178 GSSEAMGTYG-RYLQEASGTYLPV---DACREKLQNQDDVDL--------GHVCVQMDAGQGACH 230
            |.:|....:. |:::      ||:   :||:..|:.::..|:        |...::.|    ||.
  Rat   599 GITEDKIAFNLRFVR------LPIADREACQRWLRTKNSNDVFSQNMFCSGDPTLKHD----ACQ 653

  Fly   231 GDTGGPL-IDEQQR----LVGIGNWGVPCGRGYPDVYARTAFYHDWIR 273
            ||:||.. :.::.|    ..||.:||:.||.|| ..|.:...|.|||:
  Rat   654 GDSGGVFAVRDRSRDIWVATGIVSWGIGCGEGY-GFYTKLLNYVDWIK 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 66/255 (26%)
Tryp_SPc 52..275 CDD:238113 67/257 (26%)
C1rNP_001128027.1 CUB 27..138 CDD:214483
FXa_inhibition 161..189 CDD:291342
CUB 195..302 CDD:278839
Sushi 309..371 CDD:278512
Sushi 376..447 CDD:278512 6/33 (18%)
Tryp_SPc 463..699 CDD:214473 66/255 (26%)
Tryp_SPc 464..701 CDD:238113 67/257 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.