DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Elane

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:285 Identity:78/285 - (27%)
Similarity:123/285 - (43%) Gaps:59/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TNRWNLTVLLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWI 66
            :|:...::||.|.|:.               |.||:             .::||..|....||::
  Rat    11 SNQTLASMLLALLLVC---------------PALAS-------------EIVGGRPAQPHAWPFM 47

  Fly    67 ASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDW--WDLYAPYYTVSQIHVHC 129
            .|:|.. ..|.|||.::...:|::||.||.|....::.||.|..|.  .:.....::|.:|..: 
  Rat    48 VSLQRR-GGHFCGATLIARNFVMSAAHCVNGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFEN- 110

  Fly   130 NFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEG----DKLTFAGWGSSEAMGTYGRYL 190
            .||.....|||.::||:.....|   .|:.:|::....:|    ......|||...........|
  Rat   111 GFDPSRLLNDIVIIQLNGSATIN---ANVQVAELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVL 172

  Fly   191 QEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQ-GACHGDTGGPLIDEQQRLV-GIGNW--- 250
            ||.:.|.: .:.||.::         :||..:...| |.|.||:||||:  ...|| ||.::   
  Rat   173 QELNVTVV-TNLCRRRV---------NVCTLVPRRQAGICFGDSGGPLV--CNNLVQGIDSFIRG 225

  Fly   251 GVPCGRG-YPDVYARTAFYHDWIRT 274
            |  ||.| |||.:|..|.:.|||.:
  Rat   226 G--CGSGFYPDAFAPVAEFADWINS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 68/232 (29%)
Tryp_SPc 52..275 CDD:238113 70/235 (30%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 68/232 (29%)
Tryp_SPc 33..249 CDD:238113 70/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.