DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Prss38

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:267 Identity:74/267 - (27%)
Similarity:115/267 - (43%) Gaps:72/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPL----------NLL 104
            |:::||....:..|||..||..| .:|:||..||:..||||||.|.|..:.|          ||.
  Rat   112 GKLLGGELTIDRKWPWQVSIHYA-GFHVCGGSILNAYWVLTAAHCFAREKRLQTFDMYVGITNLE 175

  Fly   105 VVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYH---NDIALLQLSSKIEFNDV-------TKNIT 159
            |......|::       ::|:.:|..|:  ::|   .|:||:|..|.|.|:|.       :.|:.
  Rat   176 VANKHTQWFE-------INQVIIHPTFE--MFHPVGGDVALVQSKSAIVFSDYVLPICLPSSNLN 231

  Fly   160 LADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEA----------------SGTYLPVDACREKLQ 208
            |:|:       .....|||.....|..|:.|.||                :...||...|...::
  Rat   232 LSDL-------SCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTSYLLPEMLCAGDIK 289

  Fly   209 NQDDVDLGHVCVQMDAGQGACHGDTGGPL---IDEQQRLVGIGNWGVPCGRG-YPDVYARTAFYH 269
            |..:|               |.||:|.||   :::....:||.:||..|.:. ||.|:|..:::.
  Rat   290 NMKNV---------------CEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFL 339

  Fly   270 DWIRTTM 276
            :|||..|
  Rat   340 NWIRYNM 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 69/260 (27%)
Tryp_SPc 52..275 CDD:238113 72/262 (27%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 70/258 (27%)
Tryp_SPc 116..342 CDD:214473 69/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.