DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and LOC286960

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:240 Identity:67/240 - (27%)
Similarity:112/240 - (46%) Gaps:32/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCV-----AGLRPLNLLVVTGTV 110
            :::||.|..:...|:..|:.:..| |.||..::.:.|||:||.|.     ..|...|:.|:.|..
  Rat    23 KIVGGYTCPKHLVPYQVSLHDGIS-HQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGE 86

  Fly   111 DWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITL----ADIDELEEGDK 171
            .:.|       ..:|..|..::|....|||.|::|.|....|.....::|    |..|.     :
  Rat    87 QFID-------AEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDA-----Q 139

  Fly   172 LTFAGWGSSEAMGTYGRY---LQEASGTYLPVDACREKLQNQDDVDLGHVCVQ-MDAGQGACHGD 232
            ...:|||::.::|  |:|   ||......|...:|::....|  :.....|:. ::.|:.:|.||
  Rat   140 CLVSGWGNTVSIG--GKYPALLQCLEAPVLSASSCKKSYPGQ--ITSNMFCLGFLEGGKDSCDGD 200

  Fly   233 TGGPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTM 276
            :|||::...: :.||.:||..|. ||.|.||.:...|..||:.||
  Rat   201 SGGPVVCNGE-IQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 63/234 (27%)
Tryp_SPc 52..275 CDD:238113 65/236 (28%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 63/234 (27%)
Tryp_SPc 24..243 CDD:238113 65/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.