DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG30288

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:248 Identity:60/248 - (24%)
Similarity:110/248 - (44%) Gaps:41/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWW 113
            :.|:.||..|...:.||:..:..: ...:||..::...:||||..|::   |:.:.|..|.   :
  Fly    40 RARIDGGRDAGMESNPWMVRVMIS-GKAVCGGSLITARFVLTAEHCIS---PMYMNVRLGE---Y 97

  Fly   114 DLYAPYYTVSQI-----HVHCNFDKPLYHN----DIALLQLSSKIEFNDVTKNITLADIDELEEG 169
            |...|.:.....     ..:.:.|:.:.|:    ||.||::...:.|::..:.|.|. :.:...|
  Fly    98 DTRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPGYDIGLLRMQRSVIFSNYVRPICLI-LGKTLGG 161

  Fly   170 DKLT-----FAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAG---Q 226
            :.|:     |.|||:: :.|.....||.|:...||..:|....:   .:|:.::|    ||   .
  Fly   162 NPLSILRFNFTGWGTN-SDGEEQDRLQTATLQQLPQWSCERPGR---PLDISYIC----AGSYIS 218

  Fly   227 GACHGDTGGPL-----IDEQQRL--VGIGNWGVPCGRGYPDVYARTAFYHDWI 272
            .:|.||:||||     .:.|.|:  .|:.:.|:....|. .:|.....:.|||
  Fly   219 DSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGL-GIYTNVTHFTDWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 58/244 (24%)
Tryp_SPc 52..275 CDD:238113 59/245 (24%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 58/244 (24%)
Tryp_SPc 45..270 CDD:238113 57/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.