DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG30287

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:315 Identity:87/315 - (27%)
Similarity:126/315 - (40%) Gaps:94/315 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTVLLGLTLLALQG-----PTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWI 66
            |.:|:.|..|.:||     ..:.:..|.|  |||.              |||.|..|...:.||:
  Fly     8 LLLLIALVFLKVQGQPHLLDPQCVTARSE--PGLY--------------RVINGKPADLFSNPWM 56

  Fly    67 ASIQNAYSYHLCGAIILDETWVLTAA----------------------------SCVAGLRPLNL 103
            ..|... ....||..::...:|||||                            .|:...|.:| 
  Fly    57 VIIIER-GMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREIN- 119

  Fly   104 LVVTGTVDWWDLYAP-YYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDE-- 165
              ||.|      |.| :||        ||.|    ||||||:|.:.:::.|..::|.|...|.  
  Fly   120 --VTRT------YVPSHYT--------NFRK----NDIALLRLETTVQYGDNIRSICLLMGDYTW 164

  Fly   166 ----LEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQ 226
                |:...|....|||.:|:. .....||:||.|:..:..|.:....|  :|..|:||....| 
  Fly   165 SSNILKNLVKFNTTGWGRTESR-INSPVLQQASLTHHHLSYCAQVFGKQ--LDKSHICVASSTG- 225

  Fly   227 GACHGDTGGPL-----IDEQQRLV--GIGNWG-VPC-GRGYPDVYARTAFYHDWI 272
            ..|.||:||||     |..::|::  |:.::| |.| |   |.||.....:.:||
  Fly   226 STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG---PTVYTNVIHFANWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 74/264 (28%)
Tryp_SPc 52..275 CDD:238113 75/265 (28%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 74/264 (28%)
Tryp_SPc 42..280 CDD:238113 75/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.