DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG30083

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:248 Identity:70/248 - (28%)
Similarity:111/248 - (44%) Gaps:33/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYH-------LCGAIILDETWVLTAASCVAGLRPLNLLVVTG 108
            :::.|..|..|..||:|.|   :.|:       :||..::.:.:||:||.|:.  |...|.|..|
  Fly    33 KIMHGQNAENGTNPWMAYI---FKYNDKEVAELVCGGTLIHKQFVLSAAHCIK--RDQILAVRLG 92

  Fly   109 TVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLT 173
            .    ...:.|:.|::...:..|....|.|||.:|::...::||.|.:.|.:. .|..:..:..|
  Fly    93 E----HSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICII-TDPTKVPNVKT 152

  Fly   174 F--AGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGP 236
            |  ||||.:| ..|:.:.|:......|....|...|  ..:|....:|.....|. .|.||:|||
  Fly   153 FKAAGWGKTE-NETFSKVLKTVELNELNASECYNML--WVNVTESQICAGHPDGD-TCAGDSGGP 213

  Fly   237 LI-----DEQQRLV--GIGNWGVP-CGRGYPDVYARTAFYHDWIRTTMNGCTI 281
            ||     |...|.|  ||.::|.. |..  |.||.|.:.:.|||...::..|:
  Fly   214 LIHPVYMDGSLRYVQLGIISFGSSLCNS--PGVYTRLSSFIDWILMVVDNYTV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 67/237 (28%)
Tryp_SPc 52..275 CDD:238113 69/239 (29%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 67/237 (28%)
Tryp_SPc 34..255 CDD:238113 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.