DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG30031

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster


Alignment Length:241 Identity:69/241 - (28%)
Similarity:113/241 - (46%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VPQ--GRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGT 109
            :||  ||::||:.....::||..|:|.:.| |.||..|.....::|||.|:..:....|.:..|:
  Fly    24 LPQLDGRIVGGSATTISSFPWQISLQRSGS-HSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGS 87

  Fly   110 VDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTF 174
             .:|......::||....|..::.....||||:::::..:.|:...|.|.||..:. ..|...:.
  Fly    88 -SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNP-ANGAAASV 150

  Fly   175 AGWGS----SEAMGTYGRYL--------QEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQG 227
            :|||:    |.::.:..:|:        |.||.||......|..:          :|... :|:.
  Fly   151 SGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTM----------ICAAA-SGKD 204

  Fly   228 ACHGDTGGPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWI 272
            ||.||:||||:.... |||:.:||..|. ..||.|||..|....|:
  Fly   205 ACQGDSGGPLVSGGV-LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 65/233 (28%)
Tryp_SPc 52..275 CDD:238113 65/234 (28%)
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 65/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.