DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and C1rl

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_851989.3 Gene:C1rl / 232371 MGIID:2660692 Length:482 Species:Mus musculus


Alignment Length:326 Identity:85/326 - (26%)
Similarity:123/326 - (37%) Gaps:85/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GPTEAMRMRGEPLPGLANIERH-----------------------------RSTEAVPQ-GRVI- 53
            |.|||:     ..||...|:.|                             ...|.||. ||.: 
Mouse   173 GDTEAV-----TTPGAPKIQNHCQDPYYKADQTGTLSCPSSWKWKDRQDGGEVPECVPVCGRPVV 232

  Fly    54 ---------GGTTAAEGNWPWIA--SIQNAYSYHLCGAIILDETWVLTAASCVAG------LRPL 101
                     |.:.|..||:||.|  ||     |...|..:|.:.|:||||..:..      .|..
Mouse   233 PLAENPNTFGSSRAKLGNFPWQAFTSI-----YGRGGGALLGDRWILTAAHTIYPKDSIYLRRNQ 292

  Fly   102 NLLVVTGTVDWWDLY-APYYTVSQIHVHCNFDKPLYHN---DIALLQLSSKIEFNDVTKNITLAD 162
            |:.|..|..|..:|. ...:.|.::.||.::.:...||   |||||:|..::........:.|.|
Mouse   293 NVEVFLGHTDIDELLKLGNHPVRRVVVHPDYRQHESHNFNGDIALLELEQRVPLGPNLLPVCLPD 357

  Fly   163 IDELEEGDKLTFAG-WGSSEAMGT-YGRYLQEASGTYLPV---DACREKLQNQDDVDL---GHVC 219
                  .:.|..:| ||.....|. .|....:...:.|||   :||...|..:...::   ...|
Mouse   358 ------NETLYHSGLWGYVSGFGVEMGWLTTKLKYSKLPVAPREACEAWLHQRQRTEVFSDNMFC 416

  Fly   220 V--QMDAGQGACHGDTGGPLI---DEQQRLV--GIGNWGVPCGRGYPDVYARTAFYHDWIRTTMN 277
            |  :|.. ...|.||:|...:   |...|.|  ||.:||:.||:|| ..|.:...|.|||:..:.
Mouse   417 VGEEMQV-NSVCQGDSGSVYVVWDDLALRWVATGIVSWGIGCGKGY-GFYTKVLSYMDWIKRVIE 479

  Fly   278 G 278
            |
Mouse   480 G 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 70/257 (27%)
Tryp_SPc 52..275 CDD:238113 71/259 (27%)
C1rlNP_851989.3 CUB 50..165 CDD:238001
Tryp_SPc 242..477 CDD:238113 71/247 (29%)
Tryp_SPc 242..474 CDD:214473 69/244 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.