DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Prtn3

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:247 Identity:71/247 - (28%)
Similarity:116/247 - (46%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AVPQGRVIGGTTAAEGNWPWIASIQNAY--SYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTG 108
            ||...:::||..|...:.|::||:|.:.  ..|.||..::...:|||||.|   |:.::..:||.
Mouse    24 AVQASKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHC---LQDISWQLVTV 85

  Fly   109 TVDWWDLYA-----PYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDE--- 165
            .:...||.:     ..:|:||:..: |::.....||:.||||:......   |.:.:|.:.:   
Mouse    86 VLGAHDLLSSEPEQQKFTISQVFQN-NYNPEENLNDVLLLQLNRTASLG---KEVAVASLPQQDQ 146

  Fly   166 -LEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMD-AGQGA 228
             |.:|.:....|||.........|.|||.:.|.:.. .|||.          :||..:. ...|.
Mouse   147 TLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVVTF-LCREH----------NVCTLVPRRAAGI 200

  Fly   229 CHGDTGGPLIDEQQRLVGIGNWGV-PCGR-GYPDVYARTAFYHDWIRTTMNG 278
            |.||:|||||. ...|.|:.::.: .|.. .:||.:||.:.|.|||:..:.|
Mouse   201 CFGDSGGPLIC-NGILHGVDSFVIRECASLQFPDFFARVSMYVDWIQNVLRG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 66/234 (28%)
Tryp_SPc 52..275 CDD:238113 68/236 (29%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 66/234 (28%)
Tryp_SPc 30..248 CDD:238113 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.