DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Klkb1

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_032481.2 Gene:Klkb1 / 16621 MGIID:102849 Length:638 Species:Mus musculus


Alignment Length:247 Identity:77/247 - (31%)
Similarity:119/247 - (48%) Gaps:40/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQ--NAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWW 113
            |::|||.|:.|.|||..|:|  .....||||..|:...||||||.|..|: |.        .|.|
Mouse   390 RIVGGTNASLGEWPWQVSLQVKLVSQTHLCGGSIIGRQWVLTAAHCFDGI-PY--------PDVW 445

  Fly   114 DLY------------APYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITL---ADI 163
            .:|            .|...:.::.:|..:.....:.||||::|.:.:.:.:..|.|.|   ||.
Mouse   446 RIYGGILSLSEITKETPSSRIKELIIHQEYKVSEGNYDIALIKLQTPLNYTEFQKPICLPSKADT 510

  Fly   164 DELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQ----NQDDVDLGHVCVQMDA 224
            :.:.....:|  |||.::..|.....||:|:...:|.:.|::|.:    |:..:..|:    .:.
Mouse   511 NTIYTNCWVT--GWGYTKEQGETQNILQKATIPLVPNEECQKKYRDYVINKQMICAGY----KEG 569

  Fly   225 GQGACHGDTGGPLIDEQQ---RLVGIGNWGVPCGR-GYPDVYARTAFYHDWI 272
            |..||.||:||||:.:..   :||||.:||..|.| ..|.||.:.:.|.|||
Mouse   570 GTDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKDQPGVYTKVSEYMDWI 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 75/245 (31%)
Tryp_SPc 52..275 CDD:238113 76/246 (31%)
Klkb1NP_032481.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 75/245 (31%)
Tryp_SPc 391..621 CDD:238113 74/244 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.