DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Hp

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_059066.1 Gene:Hp / 15439 MGIID:96211 Length:347 Species:Mus musculus


Alignment Length:293 Identity:65/293 - (22%)
Similarity:108/293 - (36%) Gaps:73/293 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GEPLPGLANIERHRSTEAV---PQ------GRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILD 84
            ||.||         ..|||   |:      .|:|||:..|:|::||.|.:.:.:.. ..||.::.
Mouse    80 GEKLP---------ECEAVCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKMISRHGL-TTGATLIS 134

  Fly    85 ETWVLTAASCVAGLRPLNLLV----------VTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHN- 138
            :.|:||.|.        ||.:          :|.|:..:........:.::.:|.|      |: 
Mouse   135 DQWLLTTAK--------NLFLNHSETASAKDITPTLTLYVGKNQLVEIEKVVLHPN------HSV 185

  Fly   139 -DIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPV-- 200
             ||.|::|..::...:....|.|...|.:..|.....:|||.:...    |:........|||  
Mouse   186 VDIGLIKLKQRVLVTERVMPICLPSKDYIAPGRVGYVSGWGRNANF----RFTDRLKYVMLPVAD 246

  Fly   201 -DACREKLQN---------------QDDVDLGHVCVQMDAGQ-GACHGDTGG-----PLIDEQQR 243
             |.|....:|               |..::....|..:...| ..|:||.|.     .:.::...
Mouse   247 QDKCVVHYENSTVPEKKNLTSPVGVQPILNEHTFCAGLTKYQEDTCYGDAGSAFAIHDMEEDTWY 311

  Fly   244 LVGIGNWGVPCGRGYPDVYARTAFYHDWIRTTM 276
            ..||.::...|......||.|.....||::.||
Mouse   312 AAGILSFDKSCAVAEYGVYVRATDLKDWVQETM 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 54/256 (21%)
Tryp_SPc 52..275 CDD:238113 54/258 (21%)
HpNP_059066.1 Sushi 33..86 CDD:278512 4/14 (29%)
Tryp_SPc 102..340 CDD:214473 54/256 (21%)
Tryp_SPc 103..343 CDD:238113 54/258 (21%)
Interaction with CD163. /evidence=ECO:0000250 259..264 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.