DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Prss28

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:263 Identity:69/263 - (26%)
Similarity:118/263 - (44%) Gaps:36/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSY------HLCGAIILDETWVLTAAS 93
            :|::...||.   |.| ::||.....|.|||..|:: .|||      |:||..|:...|:||||.
Mouse    18 MASVSISRSK---PVG-IVGGQCTPPGKWPWQVSLR-MYSYEVNSWVHICGGSIIHPQWILTAAH 77

  Fly    94 CVAG--LRPLNLLVVTGTVDWWDLY--APYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDV 154
            |:..  ..|....|..|.|   .||  .....:|:|.:|.:::......|:||:||::.:..:..
Mouse    78 CIQSQDADPAVYRVQVGEV---YLYKEQELLNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTN 139

  Fly   155 TKNITL-ADIDELEEGDKLTFAGWGS-SEAMGTYGRY-LQEASGTYLPVD---ACREKLQNQDDV 213
            ...::| .|....:..|:....|||: .:.:.....| |.|..   :|:.   :|:...:.:...
Mouse   140 VSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVK---IPIQDNKSCKRAYRKKSSD 201

  Fly   214 DLGHVCVQMD------AGQGACHGDTGGPLI---DEQQRLVGIGNWGVPCGRGYPDVYARTAFYH 269
            :...|.:..|      :|:|.|.||:||||:   ..:...||:.:.|:.|....|.:::|.....
Mouse   202 EHKAVAIFDDMLCAGTSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGIDCSNNLPSIFSRVQSSL 266

  Fly   270 DWI 272
            .||
Mouse   267 AWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 62/245 (25%)
Tryp_SPc 52..275 CDD:238113 64/246 (26%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 64/246 (26%)
Tryp_SPc 31..269 CDD:214473 62/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.