DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and LOC102554637

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:238 Identity:68/238 - (28%)
Similarity:111/238 - (46%) Gaps:29/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAG-----LRPLNLLVVTGTV 110
            :::||.|..|.:.|:..|:.:  .||.||..::::.||::||.|...     |...|:.|:.|. 
  Rat    23 KIVGGYTCQEHSVPYQVSLNS--GYHYCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGD- 84

  Fly   111 DWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFA 175
                  ..:...::|..|.|||:...:|||.|::|||.::.|.....:.|.. .....|.:...:
  Rat    85 ------EQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPS-SCAPAGTQCLIS 142

  Fly   176 GWGSSEAMGTYG-RYLQEASGTYLPVDACRE----KLQNQDDVDLGHVCVQ-MDAGQGACHGDTG 234
            |||::.:.|... ..||......||...|..    |:.|      ..||.. ::.|:.:|.||:|
  Rat   143 GWGNTLSFGVNDPDLLQCLDAPLLPQADCEASYPGKITN------NMVCAGFLEGGKDSCQGDSG 201

  Fly   235 GPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTM 276
            ||::...: |.||.:||..|. ...|.||.:...|.|||:.|:
  Rat   202 GPVVCNGE-LQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 65/232 (28%)
Tryp_SPc 52..275 CDD:238113 67/234 (29%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.