DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and zgc:171509

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:248 Identity:60/248 - (24%)
Similarity:102/248 - (41%) Gaps:60/248 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDL 115
            ::|||......:.||.|.:.:.|.  |||..::.|:||::||.|    :..:::|..|.   .||
Zfish    20 KIIGGHECQPHSQPWQARLDDGYG--LCGGSLIHESWVVSAAHC----KSSSIIVHLGK---HDL 75

  Fly   116 YAPYYTVSQIHV-----HCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFA 175
            :....|..:|..     |..::...::|||.|::|......|:..|.:.| ..:....|::...:
Zfish    76 FVVEDTAQEIQAEKVISHPKYNNREHNNDIMLIKLREPAVINNNVKPVPL-PTNCSHAGEQCLVS 139

  Fly   176 GWG-------------------SSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQ 221
            |||                   .::....|||.:.:..                       .|..
Zfish   140 GWGVTGDSISSTLQCLELPILSKADCKSAYGRVITKKM-----------------------FCAG 181

  Fly   222 -MDAGQGACHGDTGGPLIDEQQRLVGIGNWGVPCGR-GYPDVYARTAFYHDWI 272
             ||.|:.:|.||:|||::. ...|.||.::|:.|.. |:|.||.....|.:||
Zfish   182 FMDGGKDSCQGDSGGPVVC-NGTLKGIVSFGIGCAEPGFPGVYVEVCRYINWI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 58/246 (24%)
Tryp_SPc 52..275 CDD:238113 60/247 (24%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 58/246 (24%)
Tryp_SPc 21..234 CDD:238113 60/247 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.