DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Klk5

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_081082.1 Gene:Klk5 / 68668 MGIID:1915918 Length:293 Species:Mus musculus


Alignment Length:254 Identity:80/254 - (31%)
Similarity:126/254 - (49%) Gaps:20/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GTSIDVTRGKRL--DNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGH 76
            ||:.|::...:.  |.|....:|||.|.:.:....|:|.::........|..|:::.||:|||.|
Mouse    45 GTNRDLSTDSKSGEDTRSDSSSRIVNGSDCQKDAQPWQGALLLGPNKLYCGAVLISPQWLLTAAH 109

  Fly    77 CALDFSIEDLRIIVGTNDR---LEPGQTLFPD-EALVHCLYDIPYVYNNDIALIHVNESIIFNDR 137
            |....    .||.:|.:..   .|.||.:|.. :::.|..|..| .::||:.||.:|..|..:..
Mouse   110 CRKPV----FRIRLGHHSMSPVYESGQQMFQGIKSIPHPGYSHP-GHSNDLMLIKMNRKIRDSHS 169

  Fly   138 TQIVELSREQPPAGSTVTLTGWGAPESS---YPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGH 199
            .:.||::.:....|:...::|||...||   :|.|  ||.||:|:::.|.|:.  .:...||...
Mouse   170 VKPVEIACDCATEGTRCMVSGWGTTSSSHNNFPKV--LQCLNITVLSEERCKN--SYPGQIDKTM 230

  Fly   200 ICTFTREGEGACSGDSGGPLMWEGKLVGLVNWGR-ACGV-GMPDMYANTVYYQDWIRRT 256
            .|....||..:|.||||||::..|||.|||:||. .|.. ..|.:|.|...:..||:.|
Mouse   231 FCAGDEEGRDSCQGDSGGPVVCNGKLQGLVSWGDFPCAQRNRPGVYTNLCEFVKWIKDT 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 72/227 (32%)
Tryp_SPc 35..256 CDD:238113 73/229 (32%)
Klk5NP_081082.1 Tryp_SPc 67..286 CDD:214473 72/227 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.