DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG17242

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:215 Identity:58/215 - (26%)
Similarity:98/215 - (45%) Gaps:10/215 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 APYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVH 110
            ||:|.|:| |...|.|.|||.:|..|||...|.....:|.:.:.||:......|..|..::..:.
  Fly    27 APWQASVQ-INDKHHCGGVIYSEDIILTIAECVRKARLEFISVRVGSAQENAGGTVLKVEKMRLQ 90

  Fly   111 CLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPESSYPTVQYLQTL 175
            .|...|    :|:|::.:...:..:...:.:.|:......|:..:::|||...:..|:.:.|..:
  Fly    91 VLGLRP----SDVAILQLRSPLYLDGGIRAIPLATIPLVPGTNASVSGWGQLSAMNPSSEVLLRV 151

  Fly   176 NLTIIAHEECRERWDFHDGI-DIGHICTFTREGE--GACSGDSGGPLMWEGKLVGLVNWGRACGV 237
            ::.|.....|.........: .:|.||. ...||  .||.|..||||:...:|.|:::|..||.|
  Fly   152 DVKIQDQLMCATNLALKGRLMSVGEICA-APAGEIPYACQGFVGGPLVANNRLYGILSWQSACDV 215

  Fly   238 -GMPDMYANTVYYQDWIRRT 256
             ....:|||...::.||..|
  Fly   216 LNKSSVYANIAMFKVWIEST 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 55/210 (26%)
Tryp_SPc 35..256 CDD:238113 57/213 (27%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 57/213 (27%)
Tryp_SPc 24..232 CDD:214473 55/210 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.