DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:239 Identity:71/239 - (29%)
Similarity:114/239 - (47%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFS-IEDLRIIVG 91
            :.|...|:||.:||.....|:||||| ..|.|:|.|.||:..|:|||.||....: :.:.::..|
Human   198 KSLKTPRVVGVEEASVDSWPWQVSIQ-YDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAG 261

  Fly    92 TNDRLEPGQTLFPDEALVHCL---YDIPYVYNNDIALIHVNESIIFNDRTQIVEL---SREQPPA 150
             :|:|..    ||..|:...:   ::..|..:|||||:.:...:.|:...:.:.|   ..|..||
Human   262 -SDKLGS----FPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPA 321

  Fly   151 GSTVTLTGWG-APESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTRE-GEGACSG 213
             :.:.:.||| ..::.......|...::.:|....|.....:...:....:|....| |...|.|
Human   322 -TPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQG 385

  Fly   214 DSGGPLMWEG---KLVGLVNWGRAC-GVGMPDMYANTVYYQDWI 253
            |||||||::.   .:||:|:||..| |...|.:|.....|.:||
Human   386 DSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 68/231 (29%)
Tryp_SPc 35..256 CDD:238113 69/232 (30%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335
Tryp_SPc 204..429 CDD:214473 68/231 (29%)
Tryp_SPc 205..432 CDD:238113 69/232 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.