DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and KLK10

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:234 Identity:62/234 - (26%)
Similarity:107/234 - (45%) Gaps:27/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCA---LDFSIEDLRIIVGTNDRLEPG 99
            |.....|..|:|||:......| |:||::::.|:|||.||.   |...:.|..:::     |:..
Human    49 GSPCARGSQPWQVSLFNGLSFH-CAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLL-----LQGE 107

  Fly   100 QTLFPDEALVHCLYD------IP-YVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLT 157
            |......::||..|.      :| ....:|:.|:.:...::...|.:.::|.......|....:.
Human   108 QLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVA 172

  Fly   158 GWGAPESSYPTVQY---LQTLNLTIIAHEECRERWDFHDGIDIGH-ICTFTREGEGACSGDSGGP 218
            |||.  ::...|:|   |...::||::.:||..   |:.|:...: ||.....|:..|..|||||
Human   173 GWGT--TAARRVKYNKGLTCSSITILSPKECEV---FYPGVVTNNMICAGLDRGQDPCQSDSGGP 232

  Fly   219 LMWEGKLVGLVNWG-RACGVGM-PDMYANTVYYQDWIRR 255
            |:.:..|.|:::|| ..||... |.:|.....|..||.:
Human   233 LVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 60/230 (26%)
Tryp_SPc 35..256 CDD:238113 62/234 (26%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 62/234 (26%)
Tryp_SPc 49..269 CDD:214473 60/230 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.