DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Klk11

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:287 Identity:82/287 - (28%)
Similarity:131/287 - (45%) Gaps:42/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLSLIWLLLLGTSIDVTRGKRLDNRKLL--------------DNRIVGGQEAEDGVAPYQVSIQT 54
            ||...|.|...|.....|...|..|.:|              :.||:.|.|......|:||::  
Mouse     3 RLKSDWKLSTETREPGARPALLQARMILRLIALALVTGHVGGETRIIKGYECRPHSQPWQVAL-- 65

  Fly    55 IWKTH-ICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEP----GQTLFPDEALVHCLYD 114
            ..||. :|...::..:|:|||.||.....:    |::|.:: ||.    .|.....|:..|..::
Mouse    66 FQKTRLLCGATLIAPKWLLTAAHCRKPHYV----ILLGEHN-LEKTDGCEQRRMATESFPHPDFN 125

  Fly   115 --IPYV-YNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWG---APESSYPTVQYLQ 173
              :|.. :.|||.|:.::..:.|....|.:.||.....||::..::|||   :|:...|  ..|:
Mouse   126 NSLPNKDHRNDIMLVKMSSPVFFTRAVQPLTLSPHCVAAGTSCLISGWGTTSSPQLRLP--HSLR 188

  Fly   174 TLNLTIIAHEECRERWDFHDGIDIGHICTFTR-EGEGACSGDSGGPLMWEGKLVGLVNWGR-ACG 236
            ..|::||.|:||.:.  :...|....:|...| ||:.:|.|||||||:..|.|.|:::||: .|.
Mouse   189 CANVSIIEHKECEKA--YPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCA 251

  Fly   237 V-GMPDMYANTVYYQDWIRRTHSGCKN 262
            | ..|.:|.....|.:||   |...:|
Mouse   252 VTRKPGVYTKVCKYFNWI---HEVMRN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 69/232 (30%)
Tryp_SPc 35..256 CDD:238113 70/234 (30%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 69/232 (30%)
Tryp_SPc 48..272 CDD:238113 71/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.