DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and zgc:92590

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:242 Identity:70/242 - (28%)
Similarity:113/242 - (46%) Gaps:33/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCAL------------DFSIE 84
            |::|:||.|......|:|:.:........|...::|::|.::|.||.|            :.::|
Zfish    18 DDKIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAVSAAHCYLVANRLTVHLGEHNVAVE 82

  Fly    85 DLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPP 149
            :     ||..|::      .::.:.|..|: .|..:||..||.:.|..:||...|.|.|:.....
Zfish    83 E-----GTEQRIK------AEKVIPHPKYN-DYTLDNDFMLIKLKEPAVFNQYVQPVPLTTSCSS 135

  Fly   150 AGSTVTLTGWGAPESS---YPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICT-FTREGEGA 210
            .|....::|||...::   ||.|  ||.|||.::...:|...:.:.  |.....|. |...|:.|
Zfish   136 EGEQCLVSGWGNLINTGVVYPDV--LQCLNLPVLTRAQCEGAYGWQ--ITKNMFCAGFMEGGKDA 196

  Fly   211 CSGDSGGPLMWEGKLVGLVNWGRACG-VGMPDMYANTVYYQDWIRRT 256
            |.||||||::..|:|.|:|:||..|. .|.|.:|.....|.||:..|
Zfish   197 CQGDSGGPVICNGELRGVVSWGYGCADSGYPGVYTEVCRYTDWVAST 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 67/235 (29%)
Tryp_SPc 35..256 CDD:238113 68/237 (29%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 67/235 (29%)
Tryp_SPc 21..243 CDD:238113 68/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.